PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37624.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 304aa    MW: 34044.7 Da    PI: 9.1468
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37624.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.81.6e-32148204158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQy++Il+RRq+Rak+e ekk+ +k+rkpylheSRh hA+rR+Rg+gGrF
  KHN37624.1 148 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-IKNRKPYLHESRHLHAMRRARGNGGRF 204
                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.8E-37146207IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.055147207IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.5E-28149204IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.6E-24150172IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860152172IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.6E-24181204IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MPGKADTDDW RVERGEQIQF QSSIYSHHQP WWCGVGENAS KSSSADQLNG SIVNGITRSE  60
TNDKSGEGVA KEYQNIKHAV LSTPFTMDKH LAPNPQMELV GHSVVLTSPY SDAQHGQILT  120
TYGQQVMINP QLYGMYHARM PLPPEMEEEP VYVNAKQYHG ILRRRQSRAK AELEKKVIKN  180
RKPYLHESRH LHAMRRARGN GGRFLNKKKL ENYNSDATSD IGQNTGANPS TNSPNTQHLF  240
TNNENLGSSN ASQATVQDMH RVESFNIGYH NGNGLAELYH SQANGKKEGN CFGKERDPNN  300
GAFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-21148208262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0976640.0BT097664.1 Soybean clone JCVI-FLGm-22I24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242813.10.0uncharacterized protein LOC100789738
TrEMBLA0A0B2RZJ60.0A0A0B2RZJ6_GLYSO; Nuclear transcription factor Y subunit A-9
STRINGGLYMA13G27230.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89623144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.44e-39nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]